ACTH Antibody BIOTIN

ACTH Antibody BIOTIN

ACTH-BIOTIN

Regular price $350.00 You Pay

Supplier: FabGennix International Inc.
Host Species: Rabbit
Specificity: ACTH
Clonality: Polyclonal
Form: BIOTIN
Verified Applications: ELISA, IHC-Fr, IHC-P, IP, WB
Immunogen: Synthetic peptide corresponding to ACTH aa 138-176. 
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Purification: Immunoaffinity purified
Immunoglobin: IgG
Species Reactivity: Human~Monkey~Mouse~Rat
Quantity: 100 ug
Volume: 200 ul
Storage Conditions: Aliquot and store undiluted at -20°C or below for up to 1 year. Can be stored undiluted at 4°C for up to 1 month. Avoid freeze thaw cycles.
Web Link: https://www.fabgennix.com/ACTH-Antibody-BIOTIN