Adenine Nucleotide Translocator 2 Antibody

Adenine Nucleotide Translocator 2 Antibody

ANT2-201AP

Regular price $265.00 You Pay

Supplier: FabGennix International Inc.
Host Species: Rabbit
Specificity: Adenine Nucleotide Translocator 2
Clonality: Polyclonal
Form: Unconjugated
Verified Applications: ELISA, IHC, IP, WB
Immunogen: Synthetic peptide taken within amino acid region 150-200 on human ADP/ATP translocase 2.

Sequence:
AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK
Purification: Immunoaffinity purified
Immunoglobin: IgG
Species Reactivity: Human~Mouse~Rat
Quantity: 100 ug
Volume: 200 ul
Storage Conditions: Aliquot and store undiluted at -20°C or below for up to 1 year. Can be stored undiluted at 4°C for up to 1 month. Avoid freeze thaw cycles.
Web Link: https://www.fabgennix.com/Adenine-Nucleotide-Translocator-2-Antibody