
Adenine Nucleotide Translocator 2 Blocking Peptide
P-ANT2
Regular price
$145.00
You Pay
Supplier: FabGennix International Inc.
Description: Synthetic peptide taken within amino acid region 150-200 on human ADP/ATP translocase 2.
Sequence:
AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK
Specificity: Adenine Nucleotide Translocator 2
Verified Applications: Immunodepletion, Competition Assays
Quantity: 250 ug
Volume: 100 ul
Form: Antigenic blocking peptide
Storage Conditions: Aliquot and store undiluted at -20°C or below for up to 1 year. Can be stored undiluted at 4°C for up to 1 month. Avoid freeze thaw cycles.
Web Link: https://www.fabgennix.com/Adenine-Nucleotide-Translocator-2-Blocking-Peptide
Competition Assay Protocol Link: https://fabgennix.com/WebRoot/Store2/Shops/862cc93a-7f43-4d98-8516-1e11a7720fd8/MediaGallery/Protocols/Competition_Assay_Protocol.pdf